This is a set of python scripts that can be used to access the One Codex api. All scripts were created using Python version 3.8. Scripts have been tested in Google Colab using Python 3.7. See the demo python notebook for detailed examples:
You will need:
-
a One Codex account at https://genomes.atcc.org/ to obtain an API Key. This is required for all scripts.
- Log in or create an account on https://genomes.atcc.org
- Proceed to https://genomes.atcc.org/profile
- Click on “Copy API Key”
-
Python 3.7 or higher.
python -m venv env
source env/bin/activate
git clone https://github.com/ATCC-Bioinformatics/genome_portal_api.git
pip install /path/to/genome_portal_api
The search_text() function can be used to find assemblies and their assocaiated metadata that match a search term. The search term can either be a full- or sub-string of an organism name or an exact match of the ATCC catalog number as a character string. For the example below any of the following search terms could have been used to produce a list which contained Yersinia entercolitica: "Yersinia", "enter", "coli", "entercolitica", or "27729".
Usage:
To use search_text(), you must include your api key, a search string and a boolean id_only flag. If the id_only boolean is set
to True, then only the assembly id is retrieved.
E.g., search_text(api_key=YOUR_API_KEY,text="coli",id_only="False") return resulting metadata
E.g., x = search_text(api_key=YOUR_API_KEY,text="asp",id_only="True") return list of assembly ids
Example:
search_text_results=search_text(api_key=api_key,text="coli",id_only=False)
search_text_results is a list of dictionary objects. The first element is:
{'attributes': {'asm_launch': True,
'atcc_metadata': {'antibiotic_resistance': None,
'antigenic_prop': 'Biotype 1 serotype 8',
'bsl': 2,
'catalog_number': '27729',
'genotype': None,
'gold': True,
'isolation_new_web': 'Human blood Belgium November 7 1972',
'notes': None,
'sequencing_technology': None,
'type_strain': False},
'biosafety_level': 2,
'catalog_number': '27729',
'dna_item': '27729D-5',
'product_url': 'https://www.atcc.org/Products/All/27729',
'source_item': '27729'},
'collection_name': 'bacteriology',
'description': None,
'id': '099e5acebc284d19',
'name': 'ATCC® 27729™',
'preferred_taxonomy_name': None,
'product_id': '27729',
'product_url': 'https://www.atcc.org/Products/All/27729D-5',
'taxon_name': 'Yersinia enterocolitica'}
Specific values from each dictionary can be accessed as follows:
[(e['taxon_name'],e['attributes']['atcc_metadata']['catalog_number']) for e in search_text_results]
Output:
[('Yersinia enterocolitica', '27729'),
('Escherichia coli', 'BAA-525'),
('Mycolicibacterium fortuitum subsp. fortuitum', '6841'),
...
The search_product() function is similar to the search_text() function, except it looks for assemblies that match a particular product id. The product id used must be an exact match to return correct results.
To use search_product(), you must include your api_key, a product_id, and a boolean id_only flag. If the
id_only boolean is set to True, then only the assembly id is retrieved.
E.g., search_product(api_key=YOUR_API_KEY,product_id=35638,id_only=False) return resulting metadata
E.g., x = search_product(api_key=YOUR_API_KEY,product_id=35638,id_only=True) return only the assembly id
Example:
product_metadata = search_product(api_key=api_key,product_id="BAA-335", id_only=False)
product_metadata
product_metadata holds the following dictionary:
[{'attributes': {'atcc_metadata': {'antibiotic_resistance': None,
'antigenic_prop': 'Serogroup B',
'bsl': 2,
'catalog_number': 'BAA-335',
'genotype': None,
'gold': None,
'isolation_new_web': 'Human infection',
'notes': None,
'sequencing_technology': None,
'type_strain': False},
'product_url': 'https://www.atcc.org/Products/All/BAA-335',
'scraped_organism_name': 'Neisseria meningitidis (Albrecht and Ghon) Murray (ATCC® BAA-335™)'},
'collection_name': 'bacteriology',
'description': None,
'id': '261b0e41db924d0f',
'name': 'ATCC® BAA-335™',
'preferred_taxonomy_name': None,
'product_id': 'BAA-335',
'product_url': 'https://www.atcc.org/Products/All/BAA-335',
'taxon_name': 'Neisseria meningitidis'}]
The download_assembly() function uses an assembly id to either obtain the link to download an assembly or download an assembly directly.
To use download_assembly(), you must include your api_key, an assembly ID, a boolean download_link_only flag, and a boolean
download_assembly flag. If the download_link_only boolean is set to True, then only the assembly download link is retrieved.
If the download_assembly boolean is set to True, then only the assembly download link is retrieved.
E.g., download_assembly(api_key=YOUR_API_KEY,id=304fd1fb9a4e48ee,download_link_only="True",download_assembly="False") return assembly url
E.g., download_assembly(api_key=YOUR_API_KEY,id=304fd1fb9a4e48ee,download_link_only="False",download_assembly="True") return assembly dict
E.g., download_assembly(api_key=YOUR_API_KEY,id=304fd1fb9a4e48ee,download_link_only="False",download_assembly="False") return raw json result
Download link example:
assembly_download_link=download_assembly(api_key=api_key,id=search_product_results_assembly_id,download_link_only=True,download_assembly=False)
assembly_download_link
assembly_download_link is the url to access in order to download the assembly:
https://s3.amazonaws.com/refgenomics-userdata-production-encrypted/temporary-files/72h/assembly_5_genome_0_taxon_0/Yersinia_enterocolitica_subsp_enterocolitica_ATCC_700822_assembly_4a3fc3892d33411f.fasta?response-content-disposition=attachment%3B%20filename%3D%22Yersinia_enterocolitica_subsp_enterocolitica_ATCC_700822.fasta%22&AWSAccessKeyId=AKIA6GPUEB7CLCIK2XEI&Expires=1648018077&Signature=biFOkbIIT2VJ0YHJtyk72ZCjwFo%3D
Download assembly example:
assembly=download_assembly(api_key=api_key,id=search_product_results_assembly_id,download_link_only=False,download_assembly=True)
for contig in assembly:
print(contig)
print(assembly[contig][0:200])
assembly is a dictionary where each key is the contig header and each value is the contig sequence. The output from above:
>4a3fc3892d33411f_1 assembly_id="4a3fc3892d33411f" genome_id="a614b8c4a4664441" atcc_catalog_number="ATCC 700822" species="Yersinia enterocolitica subsp. enterocolitica" contig_number="1" topology="circular"
GTGTCACTTTCGCTTTGGCAGCAGTGTCTTGCCCGATTGCAGGATGAGTTACCTGCCACAGAATTTAGTATGTGGATACGCCCCTTACAGGCGGAACTGAGTGACAATACTCTGGCGCTTTACGCACCTAATCGTTTTGTACTGGACTGGGTCCGTGATAAGTACTTAAACAATATCAATGGCTTACTTAATGATTTCTG
>4a3fc3892d33411f_2 assembly_id="4a3fc3892d33411f" genome_id="a614b8c4a4664441" atcc_catalog_number="ATCC 700822" species="Yersinia enterocolitica subsp. enterocolitica" contig_number="2" topology="linear"
TTCAATGAATCCATTCTGCTGCGGGTTTACCCGGTTGAATATGGCACAAAGTAATACCATTATATTCACAGTAATTCAGTAAGTTAACCGATATCAGTTCCGGACCATTATCAACTCTAATTTGCTGAGGCTGTCCACGTTCTTCTTTCAGACGTTCAAGTACGCGGATCACTCTGTTTGCTGGCAAAGAAGTATCGACT
Similar to download_assembly(), an assembly id is required for the download_annotations(), which can be used to either obtain the download link or to download the annotations directly. The annotations are in .gbk format.
To use download_annotations(), you must include your api_key, an assembly ID, a boolean download_link_only flag, and a boolean
download_annotations flag. If the download_link_only boolean is set to True, then only the assembly download link is retrieved.
If the download_annotations boolean is set to True, then only the assembly download link is retrieved.
E.g., download_annotations(api_key=YOUR_API_KEY,id=304fd1fb9a4e48ee,download_link_only="True",download_annotations="False") return annotation data url
E.g., download_annotations(api_key=YOUR_API_KEY,id=304fd1fb9a4e48ee,download_link_only="False",download_annotations="True") return the raw genbank file
E.g., download_annotations(api_key=YOUR_API_KEY,id=304fd1fb9a4e48ee,download_link_only="False",download_annotations="False") return the raw json result
Download annotation link example:
annotations_download_link=download_annotations(api_key=api_key,id=search_product_results_assembly_id,download_link_only=True,download_annotations=False)
annotations_download_link
annotations_download_link is the url to access in order to download the annotations:
https://s3.amazonaws.com/refgenomics-userdata-production-encrypted/temporary-files/72h/assembly_5_genome_0_taxon_0/Yersinia_enterocolitica_subsp_enterocolitica_ATCC_700822_assembly_0518695e1d044c30.gbk?response-content-disposition=attachment%3B%20filename%3D%22Yersinia_enterocolitica_subsp_enterocolitica_ATCC_700822.gbk%22&AWSAccessKeyId=AKIA6GPUEB7CLCIK2XEI&Expires=1648018483&Signature=ZYq0cN6ONumf2iHsEQx7%2F4hsctY%3D
Download annotations directly example:
annotations=download_annotations(api_key=api_key,id=search_product_results_assembly_id,download_link_only=False,download_annotations=True)
for line in annotations.split("\n"):
print(line)
The output from the above code block prints each link of the .gbk file.
LOCUS 1 4533095 bp DNA linear UNK 07-DEC-2021
DEFINITION Yersinia enterocolitica subsp. enterocolitica ATCC® 700822™, contig
1.
ACCESSION assembly_4a3fc3892d33411f_1
VERSION assembly_4a3fc3892d33411f_1
DBLINK assembly: 4a3fc3892d33411f
annotation_set: 0518695e1d044c30
genome: a614b8c4a4664441
KEYWORDS .
SOURCE https://genomes.atcc.org/genomes/a614b8c4a4664441
ORGANISM Yersinia enterocolitica subsp. enterocolitica
cellular organisms; Bacteria; Proteobacteria; Gammaproteobacteria;
Enterobacterales; Yersiniaceae; Yersinia; Yersinia enterocolitica;
Yersinia enterocolitica subsp. enterocolitica.
COMMENT Annotated using prokka 1.14.0 from
https://github.com/tseemann/prokka.
FEATURES Location/Qualifiers
source 1..4533095
/organism="unknown"
/mol_type="genomic DNA"
/strain="strain"
CDS 1..1389
/gene="dnaA"
/locus_tag="HEHAGAAE_00001"
/inference="ab initio prediction:Prodigal:2.6"
/inference="similar to AA sequence:UniProtKB:P03004"
/codon_start=1
/transl_table=11
/product="Chromosomal replication initiator protein DnaA"
/db_xref="COG:COG0593"
/translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FVLDWVRDKYLNNINGLLNDFCGSEVPLLRFEVGSKPAVRAHSHPVTASVSAPVAPVTR
SAPVRPSWDSSPAQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPL
FLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
SVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRF
...
...
The annotations can be printed to a file as follows:
with open("annotations.gbk", "w") as f:
for line in annotations.split("\n"):
f.write(line+"\n")
download_metadata() should be used to obtain the detailed metadata including qc statistics, contig length(s), etc. for any given assembly id.
To use download_metadata(), you must include your api_key and an assembly ID.
E.g., download_metadata(api_key=YOUR_API_KEY,id=304fd1fb9a4e48ee) return metadata
The detailed metadata can be downloaded as follows:
assembly_metadata = download_metadata(api_key=api_key,id=search_product_results_assembly_id)
assembly_metadata
assembly_metadata is a dictionary:
{'attributes': {'atcc_metadata': {'antibiotic_resistance': None,
'antigenic_prop': '3',
'bsl': 2,
'catalog_number': '700822',
'drug_repository': None,
'genotype': None,
'gold': None,
'isolation_new_web': 'Blood',
'notes': None,
'sequencing_technology': None,
'type_strain': False},
'product_url': 'https://www.atcc.org/Products/700822'},
'collection_name': 'bacteriology',
'description': None,
'id': 'a614b8c4a4664441',
'name': 'ATCC® 700822™',
'preferred_taxonomy_name': None,
'primary_assembly': {'attributes': {'contig_lengths': [4533095, 10119],
'length': 4543214,
'qc_statistics': {'assembly_level': 'Chromosome',
'assembly_statistics': {'filtered': {'contig_statistics': [{'ambiguous_nucleotide_count': 0,
'circular': True,
'gc_content': 0.47005809496602213,
'id': '1',
'illumina_depth': {'max': 1154,
'mean': 303.71365479876334,
'median': 304,
...
...
download_all_genomes() allows the user to download all genomes available on https://genomes.atcc.org without prior knowledge of any associated metadata.
To use download_all_genomes(), you must include your api_key, and a page number.
E.g., download_all_genomes(api_key=YOUR_API_KEY,page=1,output="output.txt") return page 1 of metadata
download_catalogue() allows the user to download the entire catalogue available on https://genomes.atcc.org and either return a list of all assembly metadata or save the list to a pkl file. The complete catalogue can be returned from the function as a list by not including an output path. The complete catalogue can be saved to a .pkl file by including an output path. Saving to file is required to run the search_fuzzy() function.
To use download_catalogue(), you must include your api_key.
E.g., download_catalogue(api_key=YOUR_API_KEY,output="output.txt")
The entire catalogue can be downloaded as follows:
catalogue = download_catalogue(api_key=api_key)
catalogue[0]
catalogue is a list of dictionaries. The first element is:
{'attributes': {'atcc_metadata': {'antibiotic_resistance': None,
'antigenic_prop': None,
'bsl': 2,
'catalog_number': 'BAA-1845',
'drug_repository': None,
'genotype': None,
'gold': None,
'isolation_new_web': 'Patient with typical disseminated gonococcal infection (DGI) symptoms',
'notes': None,
'sequencing_technology': 'Illumina + Oxford Nanopore',
'type_strain': False},
'product_url': 'https://www.atcc.org/Products/All/BAA-1845'},
'collection_name': 'bacteriology',
'description': None,
'id': 'd2546e5050bc4f63',
'name': 'ATCC® BAA-1845™',
'preferred_taxonomy_name': None,
'product_id': 'BAA-1845',
'product_url': 'https://www.atcc.org/Products/All/BAA-1845',
'taxon_name': 'Neisseria gonorrhoeae'}
In order to use search_fuzzy(), the catalogue must be saved to file. For example:
download_catalogue(api_key=api_key,output="path/to/catalogue.pkl")
search_fuzzy() allows the user to search for a term using fuzzy matching. The function searches through every value in the metadata nested dictionary and looks for a fuzzy match with the search term. To use this function, you must have downloaded the complete catalogue using download_catalogue(api_key=api_key,output="path/to/catalogue.pkl") because the catalogue path is a required argument.
To use search_fuzzy(), you must include a search term and the path to the catalogue
downloaded via download_catalogue().
E.g., search_fuzzy(term="coly",catalogue_path="path/to/catalogue.txt") search for the term "coly"
For example, searching for the term "yursinia" (a misspelling of yersinia) works as follows:
match_list=search_fuzzy(term="yursinia",catalogue_path="path/to/catalogue.pkl")
[e['taxon_name'] for e in match_list]
match_list is a list of dictionaries. The taxon_name for each element output from the above code:
['Yersinia enterocolitica',
'Yersinia pseudotuberculosis',
'Yersinia enterocolitica subsp. enterocolitica',
'Yersinia pestis',
'Yersinia pseudotuberculosis',
'Yersinia pseudotuberculosis',
'Yersinia pestis',
...
First, we search for Escherichia coli using search_text(). Then we iterate through the results list, create a dictionary entry for each assembly, and then download and store the assembly, annotations, and metadata. The first 3 assemblies are downloaded below.
search_text_results=search_text(api_key=api_key,text="Escherichia coli",id_only=False)
e_coli_data = {}
# Download assembly, annotations, and metadata for first 5
for e in search_text_results[:3]:
id = e['id']
e_coli_data[id] = {}
e_coli_data[id]["assembly"] = download_assembly(api_key=api_key,id=e['id'],download_link_only=False,download_assembly=True)
e_coli_data[id]["annotations"] = download_annotations(api_key=api_key,id=e['id'],download_link_only=False,download_annotations=True)
e_coli_data[id]["metadata"] = download_metadata(api_key=api_key,id=e['id'])
for id in e_coli_data.keys():
print("First 150 nts of each contig")
for contig in e_coli_data[id]["assembly"].keys():
print(contig)
print(e_coli_data[id]["assembly"][contig][0:150])
print("\nFirst 10 lines of the annotation data:")
for line in e_coli_data[id]["annotations"].split("\n")[:10]:
print(line)
print("\nSome example metadata:")
print("contig_lengths:",e_coli_data[id]["metadata"]["primary_assembly"]["attributes"]["contig_lengths"])
print("checkm_results:",e_coli_data[id]["metadata"]["primary_assembly"]["attributes"]["qc_statistics"]["checkm_results"])
break
Output:
First 150 nts of each contig
>8ee16eff570c4cef_1 assembly_id="8ee16eff570c4cef" genome_id="aa07e8781d624001" atcc_catalog_number="ATCC BAA-525" species="Escherichia coli" contig_number="1" topology="linear"
TTGGCGCATTAAAACCTGGCGCACGCCTGATTACTAAAAATCTGGCGGAGCAATTAGGTATGAGTATTACACCTGTGCGTGAAGCATTATTACGTCTGGTTTCGGTGAATGCGCTTTCTGTCGCACCTGCACAAGCATTTACAGTTCCGG
>8ee16eff570c4cef_2 assembly_id="8ee16eff570c4cef" genome_id="aa07e8781d624001" atcc_catalog_number="ATCC BAA-525" species="Escherichia coli" contig_number="2" topology="linear"
TACTAAGCTGATGTTTCAGGTCGTTCTCAACCTGCAGAGTCAAACTGACATGTTTCATTTTTCCCGTTCCAGGCATTTTAATTCCTTCGCGTGTTTTCTGTCCAACCCTGCCTGCATGGCAGAAGGAATTCACCTGGTGTATTAAAGTGA
>8ee16eff570c4cef_3 assembly_id="8ee16eff570c4cef" genome_id="aa07e8781d624001" atcc_catalog_number="ATCC BAA-525" species="Escherichia coli" contig_number="3" topology="linear"
TCGGCAAAGGAGCCATGGATTCTAGCAACTAACTTACCTGTTGAAATTCGAACACCCAAACAACTTGTTAATATCTATTCGAAGCGAATGCAGATTGAAGAAACCTTCCGAGACTTGAAAAGTCCTGCCTACGGACTAGGCCTACGCCAT
>8ee16eff570c4cef_4 assembly_id="8ee16eff570c4cef" genome_id="aa07e8781d624001" atcc_catalog_number="ATCC BAA-525" species="Escherichia coli" contig_number="4" topology="linear"
CGCTGAGTAGATTTTAGGTGACGGGTGGTGACAATGAGTCCGTGTCGAGCGCTGATTTTTTCGGCCTTTAGAGCGAGATTTATACAATAGAATTTGGCATGAGATTGGATTGCTTTTAGTCAGCCTCTTATAGCCTAAAGTCTTTGAGTG
>8ee16eff570c4cef_5 assembly_id="8ee16eff570c4cef" genome_id="aa07e8781d624001" atcc_catalog_number="ATCC BAA-525" species="Escherichia coli" contig_number="5" topology="linear"
TTACTTGACTGTAAAACTCTCACTCTTACCGAACTTGGCCGTAACCTGCCAACCAAAGCGAGAACAAAACATAACATCAAACGAATCGACCGATTGTTAGGTAATCGTCACCTCCACAAAGAGCGACTCGCTGTATACCGTTGGCATGCT
>8ee16eff570c4cef_6 assembly_id="8ee16eff570c4cef" genome_id="aa07e8781d624001" atcc_catalog_number="ATCC BAA-525" species="Escherichia coli" contig_number="6" topology="linear"
GAGAGTCGTGTAAAATATCGAGTTCGCACATTTTGTTGTCTGATTATTGATTTTTGGCGAAACCATTTGATCATATGACAAGATGTGTATCTACCTTAACTTAATGATTTTGATAAAAATCATTAGGGGATTCATCAG
First 10 lines of the annotation data:
LOCUS 1 4631769 bp DNA linear UNK 12-AUG-2021
DEFINITION Escherichia coli ATCC® BAA-525™, contig 1.
ACCESSION assembly_8ee16eff570c4cef_1
VERSION assembly_8ee16eff570c4cef_1
DBLINK assembly: 8ee16eff570c4cef
annotation_set: bda19b71c6d7400c
genome: aa07e8781d624001
KEYWORDS .
SOURCE https://genomes.atcc.org/genomes/aa07e8781d624001
ORGANISM Escherichia coli
Some example metadata:
contig_lengths: [4631769, 31262, 445, 413, 206, 138]
checkm_results: {'completeness': 99.96693121693121, 'contamination': 0.03720238095238095}
First, we use search_product to download the assembly metadata from which we pull out the assembly id. Then, we download the assembly, annotations, and metadata.
search_products_results=search_product(api_key=api_key,product_id="700822",id_only=False)
id = search_products_results[0]['id']
assembly=download_assembly(api_key=api_key,id=id,download_link_only=False,download_assembly=True)
annotations=download_annotations(api_key=api_key,id=id,download_link_only=False,download_annotations=True)
metadata=download_metadata(api_key=api_key,id=id)
print("First 150 nts of each contig")
for contig in assembly.keys():
print(contig)
print(assembly[contig][0:150])
print("\nFirst 10 lines of the annotation data:")
for line in annotations.split("\n")[:10]:
print(line)
print("\nSome example metadata:")
print("Filtered contig N50 value:",metadata["primary_assembly"]["attributes"]["qc_statistics"]["assembly_statistics"]["filtered"]["n50"])
print("Filtered contig GC content:",metadata["primary_assembly"]["attributes"]["qc_statistics"]["assembly_statistics"]["filtered"]["gc_content"])
print("Illumina data:",metadata["primary_assembly"]["attributes"]["qc_statistics"]["sequencing_statistics"]["illumina"]["depth"])
print("ONT data:",metadata["primary_assembly"]["attributes"]["qc_statistics"]["sequencing_statistics"]["ont"]["reads"])
Output:
First 150 nts of each contig
>4a3fc3892d33411f_1 assembly_id="4a3fc3892d33411f" genome_id="a614b8c4a4664441" atcc_catalog_number="ATCC 700822" species="Yersinia enterocolitica subsp. enterocolitica" contig_number="1" topology="circular"
GTGTCACTTTCGCTTTGGCAGCAGTGTCTTGCCCGATTGCAGGATGAGTTACCTGCCACAGAATTTAGTATGTGGATACGCCCCTTACAGGCGGAACTGAGTGACAATACTCTGGCGCTTTACGCACCTAATCGTTTTGTACTGGACTGG
>4a3fc3892d33411f_2 assembly_id="4a3fc3892d33411f" genome_id="a614b8c4a4664441" atcc_catalog_number="ATCC 700822" species="Yersinia enterocolitica subsp. enterocolitica" contig_number="2" topology="linear"
TTCAATGAATCCATTCTGCTGCGGGTTTACCCGGTTGAATATGGCACAAAGTAATACCATTATATTCACAGTAATTCAGTAAGTTAACCGATATCAGTTCCGGACCATTATCAACTCTAATTTGCTGAGGCTGTCCACGTTCTTCTTTCA
First 10 lines of the annotation data:
LOCUS 1 4533095 bp DNA linear UNK 07-DEC-2021
DEFINITION Yersinia enterocolitica subsp. enterocolitica ATCC® 700822™, contig
1.
ACCESSION assembly_4a3fc3892d33411f_1
VERSION assembly_4a3fc3892d33411f_1
DBLINK assembly: 4a3fc3892d33411f
annotation_set: 0518695e1d044c30
genome: a614b8c4a4664441
KEYWORDS .
SOURCE https://genomes.atcc.org/genomes/a614b8c4a4664441
Some example metadata:
Filtered contig N50 value: 4533095
Filtered contig GC content: 0.46992943761839084
Illumina data: {'max': 1154, 'mean': 303.12891886668774, 'median': 304.0, 'min': 12, 'stdev': 43.0585172469467}
ONT data: {'N50': 30777, 'ambiguous_bases': 0, 'median_quality': 25, 'median_quantized_percent_gc': 40, 'median_read_length': 9478, 'position_specific_quality_scores': {}, 'quantized_percent_gc_histogram': {'20': 49, '30': 2514, '40': 66891, '50': 8085, '60': 12}, 'total_bases': 1255401398, 'total_gc_bases': 589992714, 'total_reads': 77551}
First, we use search_fuzzy to download the assembly metadata for all items that fuzzy match "yersinia." Then, we pull out the assembly id for each and download the assembly, annotations, and metadata.
match_list=search_fuzzy(term="yersinia",catalogue_path="catalogue.pkl")
yersinia_data = {}
for e in match_list[:3]:
id = e['id']
yersinia_data[id] = {}
yersinia_data[id]["assembly"] = download_assembly(api_key=api_key,id=e['id'],download_link_only=False,download_assembly=True)
yersinia_data[id]["annotations"] = download_annotations(api_key=api_key,id=e['id'],download_link_only=False,download_annotations=True)
yersinia_data[id]["metadata"] = download_metadata(api_key=api_key,id=e['id'])
for id in yersinia_data.keys():
print("First 150 nts of each contig")
for contig in yersinia_data[id]["assembly"].keys():
print(contig)
print(yersinia_data[id]["assembly"][contig][0:150])
print("\nFirst 10 lines of the annotation data:")
for line in yersinia_data[id]["annotations"].split("\n")[:10]:
print(line)
print("\nSome example metadata:")
print("taxon:",yersinia_data[id]["metadata"]["taxon"])
break
Output:
First 150 nts of each contig
>02048bb2e6674f9c_1 assembly_id="02048bb2e6674f9c" genome_id="099e5acebc284d19" atcc_catalog_number="ATCC 27729" species="Yersinia enterocolitica" contig_number="1" topology="circular"
GTGTCACTTTCGCTTTGGCAGCAGTGTCTTGCCCGATTGCAGGATGAGTTACCTGCCACAGAATTTAGTATGTGGATACGCCCCTTACAGGCGGAACTGAGTGACAATACTCTGGCGCTTTACGCACCTAATCGTTTTGTACTGGACTGG
>02048bb2e6674f9c_2 assembly_id="02048bb2e6674f9c" genome_id="099e5acebc284d19" atcc_catalog_number="ATCC 27729" species="Yersinia enterocolitica" contig_number="2" topology="circular"
GTGGATAAGCAGAAATTCTCTAATTTTTCTAAAGATCATTCTTGGGAAGATATTGATTTTGAAGCACTAGAACGAGCTTCAATCGAATATTTTCAAGAACAGACTTCTTTCGATACATCCAAAACTGAAAAGAAAAGAACGCTTCGGAAA
First 10 lines of the annotation data:
LOCUS 1 4551126 bp DNA linear UNK 19-SEP-2019
DEFINITION Yersinia enterocolitica ATCC® 27729™, contig 1.
ACCESSION assembly_02048bb2e6674f9c_1
VERSION assembly_02048bb2e6674f9c_1
DBLINK assembly: 02048bb2e6674f9c
annotation_set: 4d8f7c47c7c44494
genome: 099e5acebc284d19
KEYWORDS .
SOURCE https://genomes.atcc.org/genomes/099e5acebc284d19
ORGANISM Yersinia enterocolitica
Some example metadata:
taxon: {'name': 'Yersinia enterocolitica', 'parents': [{'name': 'Yersinia', 'rank': 'genus', 'tax_id': 629}, {'name': 'Yersiniaceae', 'rank': 'family', 'tax_id': 1903411}, {'name': 'Enterobacterales', 'rank': 'order', 'tax_id': 91347}, {'name': 'Gammaproteobacteria', 'rank': 'class', 'tax_id': 1236}, {'name': 'Proteobacteria', 'rank': 'phylum', 'tax_id': 1224}, {'name': 'Bacteria', 'rank': 'superkingdom', 'tax_id': 2}, {'name': 'cellular organisms', 'rank': 'no rank', 'tax_id': 131567}], 'rank': 'species', 'tax_id': 630}